DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33627 and CG33626

DIOPT Version :9

Sequence 1:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027405.2 Gene:CG33626 / 3772257 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster


Alignment Length:170 Identity:44/170 - (25%)
Similarity:82/170 - (48%) Gaps:4/170 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIILLIFLASQSESAKAHLKLMWKTFNCVTNPDYISEHKCIIVEPEKSAISAELQYIKDLAQFNA 70
            :|::||.:...:|:.:   :|.|..|:|...|.|..:..|.|....:|.::.||:.:.:|.|...
  Fly     1 MILILIHVFHYTEAKR---RLRWDCFDCQMGPHYADQMTCQIGGTRRSLLNVELKLLTELDQIKV 62

  Fly    71 TFKLFMPRKPSRSFQKVIDVNVDICQFAKGIHGHRFMTIVIKAFGKQGSQ-LKCPHTKGLYVYPN 134
            ..|:....|.:..::|..|:..|.|:....:.....::.:..|..|..:| .|||..||...|.|
  Fly    63 YIKISTRFKSTTLYRKFFDITFDGCRVISDMVQGTMVSNMFNAVVKSSNQPRKCPVNKGTIYYHN 127

  Fly   135 INIAENLPAFLPETDFKIEMNFLSPAAHVINTTLTGFLFD 174
            |:|.:.||.|:|.....|:::|.:.....:|.:|.|.:.:
  Fly   128 ISIEDALPMFVPSAQLFIQIDFYARRQLYLNVSLRGEIIE 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33627NP_001027406.1 DUF1091 71..152 CDD:284008 22/81 (27%)
CG33626NP_001027405.2 DUF1091 62..140 CDD:284008 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I7638
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016868
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.