powered by:
Protein Alignment CG33627 and CG33783
DIOPT Version :9
Sequence 1: | NP_001027406.1 |
Gene: | CG33627 / 3772219 |
FlyBaseID: | FBgn0053627 |
Length: | 183 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027168.1 |
Gene: | CG33783 / 3771958 |
FlyBaseID: | FBgn0053783 |
Length: | 164 |
Species: | Drosophila melanogaster |
Alignment Length: | 74 |
Identity: | 21/74 - (28%) |
Similarity: | 32/74 - (43%) |
Gaps: | 14/74 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 DVNVDICQFAKGIHGHRFMTIVIKAFGKQGSQL--KCPHTKGLYV---YPNINIAENLP------ 142
::.||||.|.|....:.|:.:|..|. |..|.: .|||...:.| ..|.|:...:|
Fly 73 NMTVDICSFFKNRKRYPFVDLVYDAI-KNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPFPSGFY 136
Fly 143 --AFLPETD 149
.|:.:||
Fly 137 KLMFILKTD 145
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.