DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33627 and CG33454

DIOPT Version :10

Sequence 1:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:162 Identity:35/162 - (21%)
Similarity:65/162 - (40%) Gaps:26/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FLLIILLIFLASQSESAKAHLKLMWKTFNCVTNPDYISE----HKCII--VEPEKSAISAELQYI 62
            |:.::.|::    |:||      |.|..|.|.. .|...    |.|.:  ....|:::.....::
  Fly    11 FVAVVFLVY----SDSA------MVKMTNVVCE-SYDKSLTVFHYCRLKAYSRTKTSLHINATFL 64

  Fly    63 KDLAQFNATFKLFMPRKPSRSFQKVIDVNVDICQFAKGIHGHRFMTIVIKAFGKQGSQL--KCPH 125
            ..:...:..|::.......:.|  :.|:.||.|||.:. ..:..:.||.... |..|.:  .||:
  Fly    65 HPINSISVRFQMLKRANGYKPF--LFDITVDACQFLRK-PNNPVIKIVYNMI-KDASNINHSCPY 125

  Fly   126 TKGLYVYPNINIAENLPAFLPETDFKIEMNFL 157
              |..|..:.: ..:||...|..|:...::||
  Fly   126 --GTVVLNDFH-RISLPLPFPSGDYLSRLDFL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33627NP_001027406.1 DUF1091 71..152 CDD:461928 20/82 (24%)
CG33454NP_995887.1 DUF1091 72..148 CDD:461928 20/82 (24%)

Return to query results.
Submit another query.