DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33627 and CG33476

DIOPT Version :10

Sequence 1:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:76 Identity:25/76 - (32%)
Similarity:29/76 - (38%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KPSRSFQKVIDVNVDICQFAKGIHGHRFMTIVIKAFGKQGSQLKCPHTKGLYVYPNINIAENLPA 143
            |..|...||  .|.|.|||......:|....|.|.....||...||...|:|...|......||.
  Fly    67 KTKRVMYKV--DNFDGCQFLMNPLMNRVFGTVYKRLVVNGSFFSCPIKPGVYYIRNEGSVAMLPV 129

  Fly   144 FLPETDFKIEM 154
            |.|...::|.|
  Fly   130 FQPPGRYQITM 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33627NP_001027406.1 DUF1091 71..152 CDD:461928 23/72 (32%)
CG33476NP_995798.2 DUF1091 57..138 CDD:461928 23/72 (32%)

Return to query results.
Submit another query.