DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GatC and AT4G32915

DIOPT Version :9

Sequence 1:NP_001027263.1 Gene:GatC / 3772218 FlyBaseID:FBgn0064115 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_567909.1 Gene:AT4G32915 / 829428 AraportID:AT4G32915 Length:155 Species:Arabidopsis thaliana


Alignment Length:137 Identity:27/137 - (19%)
Similarity:51/137 - (37%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSRFYCKIATKSNEKATKLDFKQLTHPTKVPQTPVDSKFPDTSASEIQ-IDTKTIQLLERLSLVD 69
            ||.:|.:.:.|::..|.                   |...|:.:|.:| .|...:....|:||..
plant    34 SSHYYQRQSRKNHRIAR-------------------SYSSDSDSSVLQPPDVARLAQTARISLTP 79

  Fly    70 LDSERALATLKSSIQFADKIAHINTEHVRPLYTVLEHQQLQLRNDQVTEGDCRAEVLRNAKVTDE 134
            .:.|.....::..|.:..::..::...|.|.... |.....||.|.....|.| :.:|.:..:.|
plant    80 AEIEECETKIRRVIDWFGQLQQVDVNSVEPAIRA-EMDGGNLREDAPETFDNR-DSIRASIPSFE 142

  Fly   135 DYFVSPP 141
            |.::..|
plant   143 DAYLKVP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GatCNP_001027263.1 gatC 53..140 CDD:178810 18/87 (21%)
AT4G32915NP_567909.1 GatC 65..152 CDD:223793 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15004
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.