DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GatC and gatc

DIOPT Version :9

Sequence 1:NP_001027263.1 Gene:GatC / 3772218 FlyBaseID:FBgn0064115 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001288258.1 Gene:gatc / 558898 ZFINID:ZDB-GENE-060526-381 Length:184 Species:Danio rerio


Alignment Length:147 Identity:59/147 - (40%)
Similarity:88/147 - (59%) Gaps:18/147 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ATKSNEKATKLDFKQLTH---------PTKVPQTP-----VDSKFPDTSASEIQIDTKTIQLLER 64
            |..::..|.:..:.:.||         ..||||||     .:|:.|..:    :|....:..|||
Zfish    27 ALSASLSANRTSWSRWTHMRDSSNAAWTPKVPQTPTWEPVAESQLPPAT----RISPDLVDKLER 87

  Fly    65 LSLVDLDSERALATLKSSIQFADKIAHINTEHVRPLYTVLEHQQLQLRNDQVTEGDCRAEVLRNA 129
            |:|||..||..:..|:.:|:|||::..|||:.|.|:.:|||.::|.||:|.||||:|..|:|:.|
Zfish    88 LALVDFGSEEGVDCLEKAIRFADQLHVINTDGVEPMDSVLEDRELYLRDDTVTEGECAEELLQLA 152

  Fly   130 KVTDEDYFVSPPGNIPL 146
            |.|.|:||::|||||||
Zfish   153 KHTVEEYFLAPPGNIPL 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GatCNP_001027263.1 gatC 53..140 CDD:178810 40/86 (47%)
gatcNP_001288258.1 gatC 76..163 CDD:178810 40/86 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170584255
Domainoid 1 1.000 62 1.000 Domainoid score I10384
eggNOG 1 0.900 - - E1_KOG4247
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H19922
Inparanoid 1 1.050 101 1.000 Inparanoid score I4985
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007313
OrthoInspector 1 1.000 - - oto40987
orthoMCL 1 0.900 - - OOG6_107942
Panther 1 1.100 - - LDO PTHR15004
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2535
SonicParanoid 1 1.000 - - X5423
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.