DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GatC and Gatc

DIOPT Version :9

Sequence 1:NP_001027263.1 Gene:GatC / 3772218 FlyBaseID:FBgn0064115 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_083921.1 Gene:Gatc / 384281 MGIID:1923776 Length:155 Species:Mus musculus


Alignment Length:156 Identity:54/156 - (34%)
Similarity:80/156 - (51%) Gaps:29/156 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLFSSRFYCKI------ATKSNEKATKLDFKQLTHPTKVPQTPVDSKFPDTSASEI------QID 55
            |..|.||...:      |:|:|                 ||..|.:....|.|..:      ::.
Mouse     4 RAASVRFRAPLDAGRSFASKAN-----------------PQGKVQAAGLGTQAPRLVPQGSGRVS 51

  Fly    56 TKTIQLLERLSLVDLDSERALATLKSSIQFADKIAHINTEHVRPLYTVLEHQQLQLRNDQVTEGD 120
            ...|:.||||:||:..|..|:..|:.:|.|||::..::|:.|.||.:|||.:.|.||:|.|.||.
Mouse    52 PAVIEHLERLALVNFGSREAVDRLEKAIAFADQLHAVDTDGVEPLESVLEDRCLYLRSDNVAEGS 116

  Fly   121 CRAEVLRNAKVTDEDYFVSPPGNIPL 146
            |..|:|:|:....|:|||:|||||.|
Mouse   117 CAEELLQNSNHVVEEYFVAPPGNISL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GatCNP_001027263.1 gatC 53..140 CDD:178810 36/86 (42%)
GatcNP_083921.1 Glu-tRNAGln 50..136 CDD:294338 36/85 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840083
Domainoid 1 1.000 56 1.000 Domainoid score I10989
eggNOG 1 0.900 - - E1_KOG4247
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H19922
Inparanoid 1 1.050 84 1.000 Inparanoid score I5165
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007313
OrthoInspector 1 1.000 - - oto93908
orthoMCL 1 0.900 - - OOG6_107942
Panther 1 1.100 - - LDO PTHR15004
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2535
SonicParanoid 1 1.000 - - X5423
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.