DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GatC and DNApol-gamma35

DIOPT Version :9

Sequence 1:NP_001027263.1 Gene:GatC / 3772218 FlyBaseID:FBgn0064115 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001027262.1 Gene:DNApol-gamma35 / 3772064 FlyBaseID:FBgn0004407 Length:361 Species:Drosophila melanogaster


Alignment Length:103 Identity:26/103 - (25%)
Similarity:41/103 - (39%) Gaps:33/103 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DSKFPDTSASE----------IQIDTKTIQLLERLSLVD--LDSE-----RALATLKSSIQFADK 88
            |.:.||....|          |:::|.|..||  |...|  .||:     |.||..:..|...:.
  Fly   202 DFRLPDARTGEIVQPTVIRSVIELETTTCALL--LDGCDHGRDSQSLLLHRVLAPYQCGIACVES 264

  Fly    89 IAHINT------EHVRPLYTVLEHQQLQLRNDQVTEGD 120
            .:.::.      :|::   .||.|..|:|     :|||
  Fly   265 DSELSADLSDLCQHLK---HVLNHAGLRL-----SEGD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GatCNP_001027263.1 gatC 53..140 CDD:178810 21/81 (26%)
DNApol-gamma35NP_001027262.1 Pol_gamma_b_Cterm 228..361 CDD:239106 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4247
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.