DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9b and TIM9

DIOPT Version :9

Sequence 1:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_010894.1 Gene:TIM9 / 856693 SGDID:S000007256 Length:87 Species:Saccharomyces cerevisiae


Alignment Length:52 Identity:16/52 - (30%)
Similarity:30/52 - (57%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNM 57
            :.:|||..||:.:.|.||:.||::.:...|...|..|:.:|..||.:.::.:
Yeast    19 KQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERV 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 16/52 (31%)
TIM9NP_010894.1 zf-Tim10_DDP 13..74 CDD:397210 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13172
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.