DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9b and TIM10

DIOPT Version :9

Sequence 1:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_011869.1 Gene:TIM10 / 856395 SGDID:S000003530 Length:93 Species:Saccharomyces cerevisiae


Alignment Length:52 Identity:17/52 - (32%)
Similarity:32/52 - (61%) Gaps:5/52 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LYNKVTELCFSRCVD-NLSQRDLGGHEDLCVDRCVTKFARFN----QNMMKV 60
            ::||:...|:.:|:: :.|:.:|..:|..|:||||.|:...|    :||.|:
Yeast    32 MFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKM 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 17/52 (33%)
TIM10NP_011869.1 zf-Tim10_DDP 18..80 CDD:397210 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.