powered by:
Protein Alignment Tim9b and TIM10
DIOPT Version :9
Sequence 1: | NP_001027074.1 |
Gene: | Tim9b / 3772213 |
FlyBaseID: | FBgn0027358 |
Length: | 117 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011869.1 |
Gene: | TIM10 / 856395 |
SGDID: | S000003530 |
Length: | 93 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 52 |
Identity: | 17/52 - (32%) |
Similarity: | 32/52 - (61%) |
Gaps: | 5/52 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 LYNKVTELCFSRCVD-NLSQRDLGGHEDLCVDRCVTKFARFN----QNMMKV 60
::||:...|:.:|:: :.|:.:|..:|..|:||||.|:...| :||.|:
Yeast 32 MFNKLVNNCYKKCINTSYSEGELNKNESSCLDRCVAKYFETNVQVGENMQKM 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.