DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9b and Timm10b

DIOPT Version :9

Sequence 1:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001376161.1 Gene:Timm10b / 84384 RGDID:71097 Length:100 Species:Rattus norvegicus


Alignment Length:73 Identity:30/73 - (41%)
Similarity:42/73 - (57%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNMMKVYVDVQTTIN 69
            ||||:||..:||::|||||.|||.:|..|.|...|:.|:..|..|....|..:|..||.:...:.
  Rat     8 LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVHLMPALV 72

  Fly    70 AKRMEEME 77
            .:||.:.|
  Rat    73 QRRMADYE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 25/55 (45%)
Timm10bNP_001376161.1 zf-Tim10_DDP 3..64 CDD:397210 25/55 (45%)
Twin CX3C motif 25..49 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335584
Domainoid 1 1.000 60 1.000 Domainoid score I10313
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5237
OMA 1 1.010 - - QHG46708
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007069
OrthoInspector 1 1.000 - - otm44851
orthoMCL 1 0.900 - - OOG6_110413
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.