DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9b and TIMM10B

DIOPT Version :9

Sequence 1:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_036324.1 Gene:TIMM10B / 26515 HGNCID:4022 Length:103 Species:Homo sapiens


Alignment Length:73 Identity:29/73 - (39%)
Similarity:42/73 - (57%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNMMKVYVDVQTTIN 69
            ||||:||..:||::|||||.|||.:|..|.|...|:.|:..|..|....|..:|..||.:...:.
Human    11 LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALV 75

  Fly    70 AKRMEEME 77
            .:|:.:.|
Human    76 QRRIADYE 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 25/55 (45%)
TIMM10BNP_036324.1 zf-Tim10_DDP 12..67 CDD:281019 24/54 (44%)
Twin CX3C motif 28..52 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141869
Domainoid 1 1.000 60 1.000 Domainoid score I10606
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5350
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46708
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007069
OrthoInspector 1 1.000 - - oto89014
orthoMCL 1 0.900 - - OOG6_110413
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4783
SonicParanoid 1 1.000 - - X5153
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.