DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9b and Timm10b

DIOPT Version :9

Sequence 1:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001346981.1 Gene:Timm10b / 14356 MGIID:1315196 Length:109 Species:Mus musculus


Alignment Length:73 Identity:29/73 - (39%)
Similarity:42/73 - (57%) Gaps:0/73 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNMMKVYVDVQTTIN 69
            ||||:||..:||::|||||.|||.:|..|.|...|:.|:..|..|....|..:|..||.:...:.
Mouse     8 LRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVHLMPALV 72

  Fly    70 AKRMEEME 77
            .:|:.:.|
Mouse    73 QRRIADYE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 25/55 (45%)
Timm10bNP_001346981.1 zf-Tim10_DDP 9..64 CDD:308549 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831911
Domainoid 1 1.000 60 1.000 Domainoid score I10574
eggNOG 1 0.900 - - E1_KOG3479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5335
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46708
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007069
OrthoInspector 1 1.000 - - oto92582
orthoMCL 1 0.900 - - OOG6_110413
Panther 1 1.100 - - LDO PTHR13172
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.