DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim9b and timm10b

DIOPT Version :9

Sequence 1:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster
Sequence 2:NP_001096316.1 Gene:timm10b / 100124896 XenbaseID:XB-GENE-997825 Length:114 Species:Xenopus tropicalis


Alignment Length:102 Identity:41/102 - (40%)
Similarity:58/102 - (56%) Gaps:3/102 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNMMKVYVDVQTTIN 69
            ||||:||..:|||:||||||||..||:.|.:...|:.|:|.|.:||.|.|..:|..||.:..::.
 Frog     8 LRNLRDFLLVYNKMTELCFSRCAKNLNYRSVTMEEEQCLDSCASKFIRSNHRLMGAYVSLMPSVV 72

  Fly    70 AKRMEEMEENARKAEQ---QQREQEKERLKEAAATAV 103
            .:|:.|.|..|....:   |:.|.....|..||..|:
 Frog    73 QRRLAEYEGAASSVPELPSQEAELSANDLPPAAPAAL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:281019 29/55 (53%)
timm10bNP_001096316.1 zf-Tim10_DDP 5..66 CDD:367270 30/57 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9499
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5045
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007069
OrthoInspector 1 1.000 - - oto102879
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5153
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.