powered by:
Protein Alignment CheA56a and CG34028
DIOPT Version :9
Sequence 1: | NP_001027438.1 |
Gene: | CheA56a / 3772206 |
FlyBaseID: | FBgn0262595 |
Length: | 180 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033838.1 |
Gene: | CG34028 / 3885648 |
FlyBaseID: | FBgn0054028 |
Length: | 189 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 11/56 - (19%) |
Similarity: | 24/56 - (42%) |
Gaps: | 1/56 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 NRYYISFFLVKSTE-SNLPTTGAEMCPFRKGTYFVKNGVVSTEDWPPIVFKGLNRF 155
|.:|....:..:.. ||.|....::...|..|:.....::|.:.:|..:..|:.:|
Fly 111 NTFYKDIVMSSAANCSNFPQFKDKIELIRAQTFTYNKCLLSPDGFPTYLPDGIYKF 166
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45459100 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21112 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.