DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA56a and CheA86a

DIOPT Version :9

Sequence 1:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster


Alignment Length:163 Identity:54/163 - (33%)
Similarity:86/163 - (52%) Gaps:15/163 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NYEVRFESIDAVKGSTETLFLYQLRLLGRNRMINGTLIFLEDL-DETFDVLFE--SHAFKNGYWV 85
            :||..|.|:.:.:.| :...|..|||:||.|::|||...|||| ||.|.:..|  ::..::|.:.
  Fly    23 SYEAIFVSVTSEENS-KPFDLSNLRLIGRERILNGTFEILEDLDDEHFQISVEIYTNPARDGNYK 86

  Fly    86 KGIVNAAASKPCEFFNRYYISFFL---VK---STESNLPTTGAEMCPFRKGTYFVKNGVVSTEDW 144
            ...::......|.||.:|  .|:.   :|   :|:..|.||.   |.|.||.|::||..::.::|
  Fly    87 LLPMSVPRQGVCTFFKKY--GFYFRDCIKNGINTDLFLNTTS---CLFPKGHYYLKNVTINVQNW 146

  Fly   145 PPIVFKGLNRFTISYLKNGECVGGVQLTISIAE 177
            |.|:.:||.|....:.||...:|...||.||.:
  Fly   147 PKIMQRGLCRHIAFFYKNNVPMGSYNLTSSIED 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 30/87 (34%)
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:301369 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459061
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 1 1.000 - - otm74819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.