DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA56a and CheA84a

DIOPT Version :9

Sequence 1:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster


Alignment Length:160 Identity:48/160 - (30%)
Similarity:78/160 - (48%) Gaps:10/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 YEVRFESIDAVKGSTETLFLYQLRLLGRNRMINGTLIFLEDLD-ETFDVLFES--HAFKNGYWVK 86
            ||.||.||  ....|......|:|.|||.||.|||....|||| |:|.|:.|:  .:..:|.:.:
  Fly    24 YETRFISI--TSNGTNLFDFSQIRFLGRERMANGTFELKEDLDNESFSVVGETFIDSVGDGEYKQ 86

  Fly    87 GIVNAAASKPCEFFNRYYISFF---LVKSTESNLPTTGAEMCPFRKGTYFVKNGVVSTEDWPPIV 148
            ....|.....|.....|: |:|   :....:::.| .....||..||.|::|:.|:..::||.|:
  Fly    87 LPFTAPKQSVCTALKAYW-SYFEPSIKYGVKTDFP-AHTHPCPLPKGIYYIKDVVLKNDNWPVIM 149

  Fly   149 FKGLNRFTISYLKNGECVGGVQLTISIAEI 178
            .:|..:...:..||.|..|.:::...|:::
  Fly   150 PRGYLKAVANLFKNDEYGGSLEIVSQISDL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 21/85 (25%)
CheA84aNP_001027150.1 DUF1091 <124..153 CDD:284008 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I7631
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D116828at33392
OrthoFinder 1 1.000 - - FOG0009966
OrthoInspector 1 1.000 - - otm74819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.