DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA56a and CG18540

DIOPT Version :9

Sequence 1:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster


Alignment Length:166 Identity:34/166 - (20%)
Similarity:67/166 - (40%) Gaps:21/166 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KSNYEVRFESIDAVKGSTETLFLYQLRL--LGRNRM-INGTLIFLEDLDETFDV---LFESHAFK 80
            |.|:|....||.....:...:.: .||:  :.|:.. .:||..:..|:|::..|   :..|::..
  Fly    25 KPNWEATPLSIGGTTTNPSAMDM-NLRIERISRSEFGFSGTFFWNIDVDDSVMVEMRILSSYSGD 88

  Fly    81 NGYWVKGIVNAAASKPCEFFNRYYISFFLVK-STESNLPTTGAEMC-PFRKGTYFVKNGVVSTED 143
            ...:....::....|..|:.|.:|....|.. ...::||....|.. |:.|.||......::.:.
  Fly    89 ESDYKLTPMSIQPQKFTEYVNTFYKDLLLPNLGNCTDLPVYENEFVPPWPKATYNFTRCALNGQG 153

  Fly   144 WPPIVFKGLNRFTISYLKNGECV----GGVQLTISI 175
            .|.|:..|..:        ||.|    ..:::|:|:
  Fly   154 LPDILADGFYK--------GEAVITAQPNLEVTVSV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 19/85 (22%)
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 15/75 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.