DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheA56a and CG18538

DIOPT Version :9

Sequence 1:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster


Alignment Length:78 Identity:26/78 - (33%)
Similarity:31/78 - (39%) Gaps:10/78 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 EFFNRYY--ISFFLVKSTESNLPT-TGAEMCPFRKGTYFVKNGVVSTEDWPPIVFKGLNRFTISY 159
            |..|.||  :|....|.. ||:|. .|....|..|.|||....|:..:..|.||..|.      |
  Fly    98 EHLNTYYKDVSMKNFKHC-SNIPQFEGKFQPPLPKQTYFGNKCVIDGDGLPEIVPAGF------Y 155

  Fly   160 LKNGECVGGVQLT 172
            |...:|.|..|.|
  Fly   156 LIVIKCYGPGQPT 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 26/78 (33%)
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.