DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33772 and CG14456

DIOPT Version :10

Sequence 1:NP_001027146.4 Gene:CG33772 / 3772205 FlyBaseID:FBgn0053772 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:163 Identity:30/163 - (18%)
Similarity:69/163 - (42%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FRKIVANHNSKYISLYEAAISQDHTTINITLNLARNI-TADVWLKATIGQRVSKSGESYRDVFTY 95
            |:.|....:.|::| ::.........:|.::.:.:.: ..|:.::..|   .:|....|......
  Fly    29 FKDIKFWSDEKFVS-HKVVYDNSDPHLNFSMEVHQELHDVDIHVEVRI---TNKQDPYYNTNLNT 89

  Fly    96 NVNLCQVMGRGKGISLINFWMNNILRQ-SNMPRNCPLREGNYYMRNIRSEKETIPRFIRSGSFRI 159
            .:|:|:::|.... |.:..:::..:|: .|:...||:.:|.|:...|..:::.      .||:.|
  Fly    90 TLNVCRILGFANK-SPVGRFVHGFIREFGNIVETCPIAKGRYHWHRIHLKRKL------QGSYFI 147

  Fly   160 DSSVYVRDWNSVNLTETIF-------YVDIKMK 185
            :...:..|..:..|.|..|       :||...|
  Fly   148 NKFWWPEDPTTAMLPELEFEIIWQAMHVDASKK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33772NP_001027146.4 DUF1091 89..182 CDD:472716 20/100 (20%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 22/106 (21%)

Return to query results.
Submit another query.