DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33772 and CG33777

DIOPT Version :9

Sequence 1:NP_001027146.4 Gene:CG33772 / 3772205 FlyBaseID:FBgn0053772 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:192 Identity:35/192 - (18%)
Similarity:72/192 - (37%) Gaps:50/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLFGIILCLVSRFLEGQKTLNFLLFRKIVANHNSKYISL----------YEAAISQDHTTINITL 62
            |||  .|.||.:|.                  |.|..||          |..::::.:..:::.:
  Fly    10 LLF--FLFLVEKFT------------------NIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRV 54

  Fly    63 NLARNITADVWLKATIGQRVSKSGESYR-DVFTYNVNLCQVMGRGKGISLINFWMNNILRQSNMP 126
            ||.:...:.:.:.|...:|.:    .|: .::.:.|:.|:.:...|...:.::........||:.
  Fly    55 NLLQKPVSRIKVNAATWKRYN----GYKPSLYNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNVN 115

  Fly   127 RNCPLREG--------NYYMRNIRSEKETIPRFIRSGSFRIDSSVYVRDWN--SVNLTETIF 178
            ..||..:.        ::....:.|   .:|  :.||.:...|..|..|..  ::|:..|||
  Fly   116 YTCPFNDDAIVEKLPISFVNNQVTS---VLP--VPSGDYLFSSHWYFYDIKRVTINVYMTIF 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33772NP_001027146.4 DUF1091 89..182 CDD:301369 19/101 (19%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 13/87 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.