DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33772 and CG33647

DIOPT Version :9

Sequence 1:NP_001027146.4 Gene:CG33772 / 3772205 FlyBaseID:FBgn0053772 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:131 Identity:26/131 - (19%)
Similarity:50/131 - (38%) Gaps:21/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 INITLNLARNI----------TADVWLKATIGQRVS----------KSGESYRDVFTYNVNLCQV 102
            :|....|.||:          |..::.:..:.|.|.          |.|....:..:.:|:.||:
  Fly    36 LNYMPELVRNVSCYLNETSHPTGSIYAEFILTQDVEDLKGIYILTFKRGSYVTNFTSSHVDYCQM 100

  Fly   103 MGRGKGISLINFWMNNILRQSNMPRNCPLR-EGNYYMRNIRSEKETIPRFIRSGSFRIDSSVYVR 166
            :...:...|.......:...:|.|..|||: ...||.:......:.||.::...:|..|:.:.|:
  Fly   101 LSSVENHFLFRMVTTQLRETANFPIQCPLKMNKRYYAKGFTVNSKFIPSYMPETNFISDAHLSVK 165

  Fly   167 D 167
            |
  Fly   166 D 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33772NP_001027146.4 DUF1091 89..182 CDD:301369 17/80 (21%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:284008 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.