DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33904 and H2bl1

DIOPT Version :9

Sequence 1:NP_001027296.1 Gene:His2B:CG33904 / 3772203 FlyBaseID:FBgn0053904 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_081340.1 Gene:H2bl1 / 69382 MGIID:1916632 Length:123 Species:Mus musculus


Alignment Length:122 Identity:53/122 - (43%)
Similarity:72/122 - (59%) Gaps:9/122 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AKKAGKAQKNITKTDKKKKRKRKE---------SYAIYIYKVLKQVHPDTGISSKAMSIMNSFVN 65
            ||...|.|..|.:..:...||...         :|::||.:|||:|.|:.||||.::.|||..:|
Mouse     2 AKPTFKRQCYIKRHLRPLYRKHSRCSSINLGHGNYSLYINRVLKEVVPNRGISSYSVDIMNILIN 66

  Fly    66 DIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS 122
            |||||||.||.:.....||.|:|..:||.||.||||.:||..||:.|:|||.::..|
Mouse    67 DIFERIATEACQQMFLRKRCTLTPGDIQQAVHLLLPKKLATLAVTFGSKAVHRFIHS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33904NP_001027296.1 H2B 33..121 CDD:197718 45/96 (47%)
H2bl1NP_081340.1 H2B 1..120 CDD:304987 52/117 (44%)
Histone <13..100 CDD:278551 35/86 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.