DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33904 and Hist3h2ba

DIOPT Version :9

Sequence 1:NP_001027296.1 Gene:His2B:CG33904 / 3772203 FlyBaseID:FBgn0053904 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_001104597.1 Gene:Hist3h2ba / 303175 RGDID:1307520 Length:126 Species:Rattus norvegicus


Alignment Length:128 Identity:106/128 - (82%)
Similarity:110/128 - (85%) Gaps:7/128 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MP-PKTSGKAAKKAGKAQKNITKTDKK--KKRK--RKESYAIYIYKVLKQVHPDTGISSKAMSIM 60
            || |..|..|.||..|  |.|||..||  ||||  |||||:||:||||||||||||||||||.||
  Rat     1 MPEPSRSTPAPKKGSK--KAITKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIM 63

  Fly    61 NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            ||||||||||||:||||||||||||||||||:|||||||||||||||||||||||||||||||
  Rat    64 NSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33904NP_001027296.1 H2B 33..121 CDD:197718 82/87 (94%)
Hist3h2baNP_001104597.1 H2B 12..125 CDD:355063 98/114 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4523
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3779
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm44705
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X77
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.