DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His2B:CG33904 and his-62

DIOPT Version :9

Sequence 1:NP_001027296.1 Gene:His2B:CG33904 / 3772203 FlyBaseID:FBgn0053904 Length:123 Species:Drosophila melanogaster
Sequence 2:NP_501202.1 Gene:his-62 / 186326 WormBaseID:WBGene00001936 Length:123 Species:Caenorhabditis elegans


Alignment Length:123 Identity:99/123 - (80%)
Similarity:109/123 - (88%) Gaps:0/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVN 65
            ||||.|.|.||||.|......|..||::..|||||::|||:||||||||||:|||||||||||||
 Worm     1 MPPKPSAKGAKKAAKTVVAKPKDGKKRRHARKESYSVYIYRVLKQVHPDTGVSSKAMSIMNSFVN 65

  Fly    66 DIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123
            |:|||||:||||||||||||||:||||||||||:||||||||||||||||||||||||
 Worm    66 DVFERIASEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTSSK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His2B:CG33904NP_001027296.1 H2B 33..121 CDD:197718 79/87 (91%)
his-62NP_501202.1 H2B 25..121 CDD:197718 83/95 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165000
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H128594
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100082
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.