DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33818 and AT4G40040

DIOPT Version :10

Sequence 1:NP_001027308.1 Gene:His3:CG33818 / 3772198 FlyBaseID:FBgn0053818 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_849529.1 Gene:AT4G40040 / 830165 AraportID:AT4G40040 Length:136 Species:Arabidopsis thaliana


Alignment Length:136 Identity:131/136 - (96%)
Similarity:134/136 - (98%) Gaps:0/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRK 65
            |||||||||||||||||||||||||||||||.|||||||||||||||||||||:|||||||||||
plant     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRK 65

  Fly    66 LPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130
            ||||||||||||||||||||||.||:|||||:|||||||||||||||||||||||||||||||||
plant    66 LPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR 130

  Fly   131 IRGERA 136
            ||||||
plant   131 IRGERA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33818NP_001027308.1 PTZ00018 1..136 CDD:185400 129/134 (96%)
AT4G40040NP_849529.1 PTZ00018 1..136 CDD:185400 129/134 (96%)

Return to query results.
Submit another query.