DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33818 and cenpa

DIOPT Version :9

Sequence 1:NP_001027308.1 Gene:His3:CG33818 / 3772198 FlyBaseID:FBgn0053818 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001016585.1 Gene:cenpa / 549339 XenbaseID:XB-GENE-484234 Length:150 Species:Xenopus tropicalis


Alignment Length:130 Identity:73/130 - (56%)
Similarity:90/130 - (69%) Gaps:14/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TARKSTG-GKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR 70
            |:.:|.| ..||.::.|.:|..|.           |:||||.||.|||:|||||||||||.||.|
 Frog    26 TSTRSPGRPSAPEQRKAPRATPKK-----------RFRPGTRALMEIRKYQKSTELLIRKAPFSR 79

  Fly    71 LVREIAQDFKTDLRF--QSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 133
            ||||:...:...|.:  ||.|:|||||||||:||.||||:.||::||||||:..:||||||||||
 Frog    80 LVREVCMTYACGLNYSWQSMALMALQEASEAFLVRLFEDSYLCSLHAKRVTLYVQDIQLARRIRG 144

  Fly   134  133
             Frog   145  144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33818NP_001027308.1 PTZ00018 1..136 CDD:185400 73/130 (56%)
cenpaNP_001016585.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56 12/40 (30%)
H3 44..144 CDD:128705 65/110 (59%)
H3-like 53..150 63/92 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54047
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000188
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.