powered by:
Protein Alignment His3:CG33818 and Hfe
DIOPT Version :9
Sequence 1: | NP_001027308.1 |
Gene: | His3:CG33818 / 3772198 |
FlyBaseID: | FBgn0053818 |
Length: | 136 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_445753.1 |
Gene: | Hfe / 29199 |
RGDID: | 2793 |
Length: | 360 |
Species: | Rattus norvegicus |
Alignment Length: | 37 |
Identity: | 8/37 - (21%) |
Similarity: | 18/37 - (48%) |
Gaps: | 3/37 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 SEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRG 133
|:..::|:.....:|||....:.|: :...|::.|
Rat 315 SQDMIIGIISGITICAIFFVGILIL---VLRKRKVSG 348
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1745 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.