DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His3:CG33818 and h3c13

DIOPT Version :10

Sequence 1:NP_001027308.1 Gene:His3:CG33818 / 3772198 FlyBaseID:FBgn0053818 Length:136 Species:Drosophila melanogaster
Sequence 2:XP_017952908.1 Gene:h3c13 / 100492367 XenbaseID:XB-GENE-5889771 Length:136 Species:Xenopus tropicalis


Alignment Length:47 Identity:14/47 - (29%)
Similarity:22/47 - (46%) Gaps:10/47 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TIHRSSLLRYIQHGSDFQVIFY-----FRFSFSFG--C---SFRILF 43
            |:..|.::.|.::.|..|.:|.     |..|.:.|  |   :|.|||
 Frog    93 TVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILF 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His3:CG33818NP_001027308.1 PTZ00018 1..136 CDD:185400 14/47 (30%)
h3c13XP_017952908.1 PTZ00018 1..136 CDD:185400 10/42 (24%)

Return to query results.
Submit another query.