DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG14518

DIOPT Version :9

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:183 Identity:54/183 - (29%)
Similarity:99/183 - (54%) Gaps:26/183 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LALMIVVILYGIN-----DVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILP 65
            :.|:|.::.:.:.     |..|.:.||..|.:.:.|:|.:..||:::|:|....::|::.|| .|
  Fly     3 IVLVIWMLAHSLQPPYQCDAVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLL-HP 66

  Fly    66 LTNATINVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPF---- 126
            :.:..:...|.||.|||||:||:||.|.|:|:| :::|.:::.:::|....|.| :.|||:    
  Fly    67 VHDVIVKARLLKRANGYKPWLYSVSFDGCQFIR-RRNNALIRIVWELFKEYSTI-NHTCPYVGLQ 129

  Fly   127 ---NSFISVDKLTTNFLNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNVYIT 176
               |.::..:||.|           |:|.|:||....|......:::.|||.|
  Fly   130 QVKNFYLRSEKLPT-----------PIPTGEYLLMIDWVFNKKPQAATNVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 31/92 (34%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 32/102 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.