DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG13250

DIOPT Version :9

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:145 Identity:34/145 - (23%)
Similarity:57/145 - (39%) Gaps:13/145 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LALMIVVILY----GINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPL 66
            |..::|.||:    ...|..| .:.:|.||..|.:......|.|..:.:..........||...:
  Fly    13 LCCLVVPILWQPSLATRDFDI-RWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSV 76

  Fly    67 TNATINVALYKRYNGY-KPF--LYNVSVDACRFLR-TQKSNIVVKYLFDLILLKSNIRSPTCPFN 127
            |...:.:::.:..|.. :|.  |:.:.||.|..:. ..||.|:...|..  ||:|......||. 
  Fly    77 TKMWVELSVGQIANRKDRPVQQLFKIRVDGCHLIEFRSKSRILNAVLHK--LLQSGNYPDACPL- 138

  Fly   128 SFISVDKLTTNFLNN 142
             ..:|:..:|.|..|
  Fly   139 -LANVNYTSTRFALN 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 19/76 (25%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 18/62 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.