DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG13589

DIOPT Version :9

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:171 Identity:48/171 - (28%)
Similarity:92/171 - (53%) Gaps:19/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALMIVVILYGI---NDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTN 68
            |..:|.::.|.   .:..:.:.||..|.|.:.|:|....||:|:.:||...:::|: ..|.|..|
  Fly     6 AAFVVSVILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINA-TFIEPAKN 69

  Fly    69 ATINVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVD 133
            ..:::.:.|:.|||||||::.:.|||.|:| :::....|.::::|...|.: :.|||:...    
  Fly    70 IYLHMKMMKKANGYKPFLFDYTFDACEFMR-RRNQPFAKIVWNMIKNVSTV-NHTCPYEGL---- 128

  Fly   134 KLTTNFLNNKLTQVLPVPEGDYLFAFRW-------FSYNIY 167
            ::.::|  :.:...:|:|.||||....|       |:.|:|
  Fly   129 QMLSDF--HHIDVPVPLPSGDYLLLLDWIFDFKPQFATNVY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 25/85 (29%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 27/93 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472469
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.