DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG33723

DIOPT Version :9

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster


Alignment Length:173 Identity:76/173 - (43%)
Similarity:118/173 - (68%) Gaps:2/173 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LALMIVVILYGINDVS-IVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNA 69
            |.:.:::::..:.::. .|||||:||.|.:..:..:..|.:||:||||||||....|..||:|.|
  Fly     8 LLVSLLLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSLHKLPITKA 72

  Fly    70 TINVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDK 134
            .:|..||||:|||:|||||.::|||.|.:.||:|.|.||.||:|...||: :.:||:|:.|.|:|
  Fly    73 RVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNL-NHSCPYNNDIIVEK 136

  Fly   135 LTTNFLNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNVYITI 177
            ::|:.:|:.:|::||.|||||:....|...:||...:.||||:
  Fly   137 VSTDTVNHHVTKILPYPEGDYMLETHWMLNDIYCGVIQVYITL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 44/85 (52%)
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472079
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.