DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG33777

DIOPT Version :9

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027108.1 Gene:CG33777 / 3772311 FlyBaseID:FBgn0053777 Length:172 Species:Drosophila melanogaster


Alignment Length:156 Identity:79/156 - (50%)
Similarity:111/156 - (71%) Gaps:1/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINVALYKRYNGYKPFL 86
            :.:||||||:|.|..:.:.:.|.:|||||||||:|:...||..|::...:|.|.:||||||||.|
  Fly    17 VEKFTNIKCTSLDPEFAHVDHCYLKSVNRTYKYLSLRVNLLQKPVSRIKVNAATWKRYNGYKPSL 81

  Fly    87 YNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNFLNNKLTQVLPVP 151
            ||.:||||:|::..|||.|..|::.|....||: :.|||||....|:||..:|:||::|.|||||
  Fly    82 YNFTVDACKFIKNPKSNPVAHYIYRLFKDYSNV-NYTCPFNDDAIVEKLPISFVNNQVTSVLPVP 145

  Fly   152 EGDYLFAFRWFSYNIYRSSVNVYITI 177
            .|||||:..|:.|:|.|.::|||:||
  Fly   146 SGDYLFSSHWYFYDIKRVTINVYMTI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 46/85 (54%)
CG33777NP_001027108.1 DUF1091 72..151 CDD:284008 44/79 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471987
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.