DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG33796

DIOPT Version :9

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:170 Identity:55/170 - (32%)
Similarity:90/170 - (52%) Gaps:12/170 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LALMIVVILYGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNAT 70
            |.::.::||...|.| :.:.||:.|.|.:.:::....||:|::||.....:.|:..| .|..:.|
  Fly    11 LTILCLMILKPSNPV-VFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFL-YPTKSIT 73

  Fly    71 INVALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDK- 134
            ::...:||.|||:|:|.|..:|.|||||.....:.: .||::....:|| :.|||....:.|.. 
  Fly    74 VHYQTFKRENGYRPWLVNTQIDGCRFLRKPYDALGI-LLFNIYRNFTNI-NHTCPLQGDMIVRNM 136

  Fly   135 -LTTNFLNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNV 173
             |||:.:.      ||:|.||||.|..|..|...:.:.||
  Fly   137 YLTTDVMR------LPLPTGDYLLAIDWIFYGKPQFATNV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 31/87 (36%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 31/87 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472470
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.