DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG33920

DIOPT Version :9

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:187 Identity:81/187 - (43%)
Similarity:124/187 - (66%) Gaps:16/187 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDLDHLALMIVVILYGINDVSIV------EFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNS 59
            |.::|..|:.::.|    .:|||      |||||.|:|.|..:..:|.|.||||||:|||:|:.:
  Fly     1 MGVNHCGLVALLAL----SISIVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKA 61

  Fly    60 RLLILPLTNATINVALYKR---YNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRS 121
            :|...|:|.  ||..:.||   ||||:||::|:::|||||:...|||.:..||:|.|...:|: :
  Fly    62 KLFKTPITK--INGVILKRFNGYNGYRPFMFNITLDACRFMNNTKSNPIASYLYDFIRPFTNM-N 123

  Fly   122 PTCPFNSFISVDKLTTNFLNNKLTQVLPVPEGDYLFAFRWFSYNIYRSSVNVYITIS 178
            ..||::..:.::||..:|:|:::|:||||||||||:...|.:|:|.|:.|.||.|||
  Fly   124 HNCPYDHDLVIEKLPIHFVNHQVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTIS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 40/88 (45%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:284008 39/87 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.