DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG33689

DIOPT Version :9

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:154 Identity:59/154 - (38%)
Similarity:92/154 - (59%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINVALYKRYNGYKPFLYNV 89
            ||||||.|.|.::..::.|.||:||||:||:.|...|..||:.|.||:..|.:..:|||||..:.
  Fly    23 FTNIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDY 87

  Fly    90 SVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTTNFLNNKLTQVLPVPEGD 154
            :.|.|:|||.|| :.::|..:.:....||| :.|||::..|.||.|.|..:.:...:.:|:..||
  Fly    88 TFDGCKFLRNQK-HPIIKLFYKIYQGSSNI-NHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGD 150

  Fly   155 YLFAFRWFSYNIYRSSVNVYITIS 178
            |.....|.:.||.|:.:|:|..::
  Fly   151 YAVYSNWSTDNIMRAYLNLYFRVT 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 30/85 (35%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
66.060

Return to query results.
Submit another query.