powered by:
Protein Alignment CG33648 and CG12898
DIOPT Version :9
Sequence 1: | NP_001027265.2 |
Gene: | CG33648 / 3772188 |
FlyBaseID: | FBgn0053648 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610581.1 |
Gene: | CG12898 / 36096 |
FlyBaseID: | FBgn0033516 |
Length: | 156 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 13/49 - (26%) |
Similarity: | 21/49 - (42%) |
Gaps: | 9/49 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 LILLKSNIRSPTCPFNSFISVDKLTTNFLNNKLTQVLPVPEGDYLFAFR 160
::..|.|| .|| ::.|.||..::.:.....||....|:.||
Fly 1 MVFQKGNI--------EFI-LESLETNCDHDYVEYFRKVPNTKLLYTFR 40
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33648 | NP_001027265.2 |
DUF1091 |
71..157 |
CDD:284008 |
10/44 (23%) |
CG12898 | NP_610581.1 |
DUF1091 |
48..129 |
CDD:284008 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.