DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33648 and CG33453

DIOPT Version :10

Sequence 1:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:167 Identity:50/167 - (29%)
Similarity:91/167 - (54%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMIVVILYGINDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATIN 72
            |..:.::..:::...::.||:.|.|.:.|:..:..||:|:.:|....:::|:..| .|..|.::.
  Fly    12 LAALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFL-HPTNNVSLR 75

  Fly    73 VALYKRYNGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLKSNIRSPTCPFNSFISVDKLTT 137
            :.:.||.:||||||::|::|||:||| ::.|.|:|..:..|...|.: :.|||:...:..|..|.
  Fly    76 LKMVKRLSGYKPFLFDVTIDACQFLR-KRHNPVIKMFYSFIKDYSTL-NHTCPYGLQVVSDYHTA 138

  Fly   138 NFLNNKLTQVLPVPEGDY-------LFAFRWFSYNIY 167
            .|       .:|:|.|||       .:|.:.|..|||
  Fly   139 VF-------PVPLPSGDYGVLLDFIFYAKKQFHVNIY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33648NP_001027265.2 DUF1091 71..157 CDD:461928 31/92 (34%)
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 29/79 (37%)

Return to query results.
Submit another query.