powered by:
Protein Alignment CG33695 and AT1G65270
DIOPT Version :9
| Sequence 1: | NP_001027248.1 |
Gene: | CG33695 / 3772186 |
FlyBaseID: | FBgn0052831 |
Length: | 305 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_564847.1 |
Gene: | AT1G65270 / 842834 |
AraportID: | AT1G65270 |
Length: | 292 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 34 |
Identity: | 12/34 - (35%) |
| Similarity: | 15/34 - (44%) |
Gaps: | 1/34 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 255 SPAGA-PAGLKCGPDVSMTLNRINVQENEVDVEE 287
||||. .|.||.......||.::....|:...||
plant 90 SPAGTFSARLKTWSHGGKTLTKLRFSRNDFSAEE 123
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG33695 | NP_001027248.1 |
SANT |
37..75 |
CDD:197842 |
|
| SANT |
38..75 |
CDD:238096 |
|
| AT1G65270 | NP_564847.1 |
None |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
O |
PTHR21397 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.
