DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33695 and c17orf49

DIOPT Version :9

Sequence 1:NP_001027248.1 Gene:CG33695 / 3772186 FlyBaseID:FBgn0052831 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001072189.1 Gene:c17orf49 / 779635 XenbaseID:XB-GENE-5900247 Length:198 Species:Xenopus tropicalis


Alignment Length:126 Identity:56/126 - (44%)
Similarity:83/126 - (65%) Gaps:18/126 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSAIKVGEIFTAAGQAFSRLGDLTMQLHPNAE-SPSG-KWTDEEIDMLHSSIMRFSDDLTKISLS 64
            :::.||||||:|||.||::||:|||||||..: ||:| :|||.||.|||:::.||.:||.:||..
 Frog     3 SASTKVGEIFSAAGAAFTKLGELTMQLHPVTDSSPAGARWTDTEIQMLHAAVKRFGEDLNQISSV 67

  Fly    65 IKNRTVSQIRQALKKKAFEDAGIPAKQVPVQQVQHVLQTLPQQQPQQPLQQPPPQVFKSQP 125
            ||.|||:||:.|:|:|.::|.|:|               |....|::.:::..| |..|.|
 Frog    68 IKERTVAQIKFAVKRKIYDDNGVP---------------LTSDSPRKSIKKASP-VSSSVP 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33695NP_001027248.1 SANT 37..75 CDD:197842 22/38 (58%)
SANT 38..75 CDD:238096 21/36 (58%)
c17orf49NP_001072189.1 Myb_DNA-binding 41..77 CDD:365977 20/35 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006351
OrthoInspector 1 1.000 - - oto104196
Panther 1 1.100 - - LDO PTHR21397
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5305
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.