DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33695 and zgc:103508

DIOPT Version :9

Sequence 1:NP_001027248.1 Gene:CG33695 / 3772186 FlyBaseID:FBgn0052831 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001008605.1 Gene:zgc:103508 / 494062 ZFINID:ZDB-GENE-041212-28 Length:204 Species:Danio rerio


Alignment Length:161 Identity:66/161 - (40%)
Similarity:95/161 - (59%) Gaps:24/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSAIKVGEIFTAAGQAFSRLGDLTMQLHPNAE-SPSG-KWTDEEIDMLHSSIMRFSDDLTKISLS 64
            :::.||||||:|||.|||:||:|||||||.|: ||:| ||||.||:||.|::.||.:||..||..
Zfish     3 SASTKVGEIFSAAGAAFSKLGELTMQLHPVADSSPAGAKWTDTEIEMLRSAVRRFGEDLNSISSV 67

  Fly    65 IKNRTVSQIRQALKKKAFEDAGIP-AKQVPVQQVQHVLQTLPQQQPQQPLQQPPPQVFKSQPIVQ 128
            ||.|||:||:..:|:|.:||:.:| ..:.|.:.::....:||         .||..|..:...|.
Zfish    68 IKERTVAQIKTTVKRKLYEDSRVPLTAESPKKTMKKSTVSLP---------APPASVAPTVITVP 123

  Fly   129 HVQLVA----------QPKQIILHPQSNTTT 149
            ..|:|.          ||  .|.:|:.:..|
Zfish   124 TSQVVVSTGLQSSSSLQP--AIKNPKPSDVT 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33695NP_001027248.1 SANT 37..75 CDD:197842 23/38 (61%)
SANT 38..75 CDD:238096 22/36 (61%)
zgc:103508NP_001008605.1 SANT 41..77 CDD:238096 21/35 (60%)
SANT 41..>77 CDD:197842 21/35 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006351
OrthoInspector 1 1.000 - - otm25900
orthoMCL 1 0.900 - - OOG6_108312
Panther 1 1.100 - - LDO PTHR21397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3404
SonicParanoid 1 1.000 - - X5305
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.