DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33695 and zgc:92664

DIOPT Version :9

Sequence 1:NP_001027248.1 Gene:CG33695 / 3772186 FlyBaseID:FBgn0052831 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001002422.1 Gene:zgc:92664 / 436695 ZFINID:ZDB-GENE-040718-119 Length:168 Species:Danio rerio


Alignment Length:182 Identity:45/182 - (24%)
Similarity:76/182 - (41%) Gaps:71/182 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSAIKVGEIFTAAGQAFSRLGDLTMQLHPNAE-SPSGKWTDEEIDMLHSSIMRFSDDLTKISLSI 65
            :::.||||||:|||.||::||:|||||||.|: :|:|                            
Zfish     3 SASTKVGEIFSAAGAAFTKLGELTMQLHPVADTTPAG---------------------------- 39

  Fly    66 KNRTVSQIRQALKKKAFEDAGIP-AKQVPVQQVQHVLQTLPQQQPQQPLQQPPPQVFKSQPIVQH 129
                 :|:..|:|:|.::|:|.| :...|.:..:.|           |:...||           
Zfish    40 -----AQMTTAVKRKLYDDSGAPLSTNSPKKSTKKV-----------PVSMAPP----------- 77

  Fly   130 VQLVAQPKQIILHPQSNTTTTGTTVTVKQYQQMQKAAALAAAQAAASTANNT 181
                 .|.::|..|.|....|.         .:|:|:...::..::.||:.|
Zfish    78 -----APPKVIAVPTSQVVVTA---------GLQRASTGPSSIKSSKTADVT 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33695NP_001027248.1 SANT 37..75 CDD:197842 2/37 (5%)
SANT 38..75 CDD:238096 1/36 (3%)
zgc:92664NP_001002422.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006351
OrthoInspector 1 1.000 - - otm25900
orthoMCL 1 0.900 - - OOG6_108312
Panther 1 1.100 - - O PTHR21397
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5305
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.