DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33695 and SPAC19D5.02c

DIOPT Version :9

Sequence 1:NP_001027248.1 Gene:CG33695 / 3772186 FlyBaseID:FBgn0052831 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_594900.1 Gene:SPAC19D5.02c / 2542392 PomBaseID:SPAC19D5.02c Length:223 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:24/105 - (22%)
Similarity:37/105 - (35%) Gaps:24/105 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 TATVVQQPHMVSTCSS---------TQIVVPVVSAVSTVPTVL------SPTVVIADDVVSTSNP 246
            |...|.:.|.:..|.|         ||:|.....:..:...|:      ||..::...|....:.
pombe    91 TLPKVPRDHYIILCDSSESNEIAKFTQVVHSFDFSSDSESAVVEQLHPSSPIPILTTAVRKKGSR 155

  Fly   247 PAAAATVGSPAGAPAGLKCGPDVSMTLNRINVQENEVDVE 286
            |:      .|.....|.|.|   |.|....||.|:|::.|
pombe   156 PS------KPQKEKQGNKQG---SKTEESPNVDEDELESE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33695NP_001027248.1 SANT 37..75 CDD:197842
SANT 38..75 CDD:238096
SPAC19D5.02cNP_594900.1 Peroxin-22 23..>142 CDD:289588 10/50 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21397
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.