DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33695 and 0610010K14Rik

DIOPT Version :9

Sequence 1:NP_001027248.1 Gene:CG33695 / 3772186 FlyBaseID:FBgn0052831 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001171072.1 Gene:0610010K14Rik / 104457 MGIID:1915609 Length:191 Species:Mus musculus


Alignment Length:130 Identity:58/130 - (44%)
Similarity:82/130 - (63%) Gaps:28/130 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSAIKVGEIFTAAGQAFSRLGDLTMQLHPNAE-SPSG-KWTDEEIDMLHSSIMRFSDDLTKISLS 64
            :::.||||||:|||.||::||:|||||||.:: ||:| |||:.||:||.:::.||.|||..||..
Mouse     3 SASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCV 67

  Fly    65 IKNRTVSQIRQALKKKAFEDAGIPAKQVPVQQVQHVLQTLPQQQPQQ-----------PLQQPPP 118
            ||.|||:||:..:|:|.:||:|||               ||.:.|::           |...|||
Mouse    68 IKERTVAQIKTTVKRKVYEDSGIP---------------LPAESPKKGPKKMTSGVLSPPNAPPP 117

  Fly   119  118
            Mouse   118  117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33695NP_001027248.1 SANT 37..75 CDD:197842 22/38 (58%)
SANT 38..75 CDD:238096 21/36 (58%)
0610010K14RikNP_001171072.1 SANT 41..77 CDD:238096 20/35 (57%)
SANT 41..>77 CDD:197842 20/35 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006351
OrthoInspector 1 1.000 - - oto93972
orthoMCL 1 0.900 - - OOG6_108312
Panther 1 1.100 - - LDO PTHR21397
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3404
SonicParanoid 1 1.000 - - X5305
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.