DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10096 and AT3G60060

DIOPT Version :10

Sequence 1:NP_001027183.1 Gene:CG10096 / 3772183 FlyBaseID:FBgn0038032 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_191565.1 Gene:AT3G60060 / 825176 AraportID:AT3G60060 Length:154 Species:Arabidopsis thaliana


Alignment Length:114 Identity:22/114 - (19%)
Similarity:47/114 - (41%) Gaps:31/114 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FYKDKTVFLTGGSGFLGKVTIAKLLCTTEVKRIYVLLRAKRGQEMRERCAAWDKDPVFGNLMKTN 72
            |...:.:|:||                    :|.::::|...:..::|.           ..:.:
plant    16 FLARERLFVTG--------------------KIVLVIKANDQEAAKKRL-----------YFQFH 49

  Fly    73 PEALKRVVPCGGDCQEPDLGLSNSDRQVLIDEVQIVIHTAATVRFVEPL 121
            |..|.:::|...|..|.:||:.:.....:.:|:.|:|.:|||..|.:.|
plant    50 PSILSKLLPVVEDIAEDNLGVDSETSLKISEEIDIIISSAATTTFDDSL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10096NP_001027183.1 FAR-N_SDR_e 12..330 CDD:187547 21/110 (19%)
Sterile 362..453 CDD:460779
AT3G60060NP_191565.1 PLN02503 <16..>114 CDD:215279 22/114 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.