DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG34260

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:160 Identity:36/160 - (22%)
Similarity:60/160 - (37%) Gaps:43/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRRFSGYRPFLFNVTVDVCHF---------LKHR 104
            :|.||..|:     |:.|   :.|..|:|...|.......|..|.|::  ||         .|.:
  Fly    27 IKTLGCQII-----AKAY---VNSLECLLVRQRTAVVAVKFSLNQTIE--HFDVLATFDLIKKDK 81

  Fly   105 KRYPFADLVYDG-------------------IKSFSNLNHTCPFNHD---IIVNQMVLNDDMISK 147
            .|...||:..||                   :||.|||..:||.:..   .|.|...::|:....
  Fly    82 SRMNIADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYTFISDEFPPG 146

  Fly   148 APVPNGFYKLRFIVKTDGVWRGEVEVHAEV 177
            ||......:|:.:.:::.|  .::.:...|
  Fly   147 APQAKWQVRLKLLKRSELV--ADISIEGAV 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 24/108 (22%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 18/80 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.