DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG13561

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:149 Identity:38/149 - (25%)
Similarity:77/149 - (51%) Gaps:10/149 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LWSYVVINLLLSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTT 74
            ||..:.:       ..:.||.|::|...:::|..:..|.|..:.|.:|.::|.|.:.:.|....:
  Fly    13 LWHILQV-------QGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVS 70

  Fly    75 CVLTLFRRFSGYRPFLFNV-TVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQM 138
            ..:.|.::.|||:|||:|: ..|||.:|: ::.:||.:::.....:.:|:| .||...:|::...
  Fly    71 MRMQLLKKASGYKPFLYNICQSDVCEYLE-KRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHF 133

  Fly   139 VLNDDMISKAPVPNGFYKL 157
            .....::...|:|.|.|.|
  Fly   134 RFPVKVLDMMPLPFGDYGL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 23/78 (29%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472295
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.