DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33919

DIOPT Version :9

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:147 Identity:35/147 - (23%)
Similarity:78/147 - (53%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSDSNALFKFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRR-F 83
            |:::..::|.|.::|.........:. |.:|.:...:..:|:...:. :|:.:....:.:|.: :
  Fly    17 LTNTQLVYKLKKIECLVNRTRVSNVS-CHVKAINWNLAVVNMDCFMI-VPLHNPIIRMQVFTKDY 79

  Fly    84 SG-YRPFLFNVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVLNDDMISK 147
            |. |:|||.:|.:.:|..::.|...|:..:::...|.::|:||:|||:..:|.....|:..::  
  Fly    80 SNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLDTSLL-- 142

  Fly   148 APVPNGFYKLRFIVKTD 164
            .|.|.|||::..:| ||
  Fly   143 PPFPQGFYQVSLVV-TD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 79..157 CDD:284008 24/79 (30%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472298
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.