DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33784 and CG33923

DIOPT Version :10

Sequence 1:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:154 Identity:52/154 - (33%)
Similarity:86/154 - (55%) Gaps:3/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHAQVYKLPIKSTTCVLTLFRRFSGYRPFLFN 92
            :|.|:||...:..|.:...|.||.:.|....|:|..::.:.||......:.:.:|.:||:|||:|
  Fly    25 EFANIKCVTLDPEFADFDYCYLKAVSRTYKYLSLRVKLLETPITKIKINVAILQRLNGYKPFLYN 89

  Fly    93 VTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPFNHDIIVNQMVL---NDDMISKAPVPNGF 154
            ||:|.|.|.|::|..|.|..:|...|.:||:||:||::|||||.::.:   |..:....|||:|.
  Fly    90 VTIDACKFYKNQKSNPIARYLYSFFKDYSNINHSCPYDHDIIVEKLPISHVNTQVTKVLPVPHGD 154

  Fly   155 YKLRFIVKTDGVWRGEVEVHAEVN 178
            |..........:.|..|:|:|.::
  Fly   155 YLFHSNWYAYDINRAIVDVYATIS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33784NP_001027169.1 DUF1091 76..157 CDD:461928 35/83 (42%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 35/84 (42%)

Return to query results.
Submit another query.